![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
![]() | Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) ![]() |
![]() | Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein) |
![]() | Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species) |
![]() | Species Streptomyces cattleya [TaxId:29303] [102525] (14 PDB entries) |
![]() | Domain d1rqpc2: 1rqp C:8-192 [97759] Other proteins in same PDB: d1rqpa1, d1rqpb1, d1rqpc1 complexed with sam |
PDB Entry: 1rqp (more details), 1.8 Å
SCOP Domain Sequences for d1rqpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqpc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei vrfnr
Timeline for d1rqpc2:
![]() Domains from other chains: (mouse over for more information) d1rqpa1, d1rqpa2, d1rqpb1, d1rqpb2 |