SCOP 1.71: Domain d1rqpc2: 1rqp C:8-192

Lineage for d1rqpc2 (1rqp C:8-192)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family)

5. Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [102525] (2 PDB entries)

8. Domain d1rqpc2: 1rqp C:8-192 [97759]
   Other proteins in same PDB: d1rqpa1, d1rqpb1, d1rqpc1
   complexed with sam

Details for d1rqpc2

PDB Entry: 1rqp, 1.8 Å

PDB Description: Crystal structure and mechanism of a bacterial fluorinating enzyme

SCOP Domain Sequences for d1rqpc2:

Sequence; same for both SEQRES and ATOM records:

>d1rqpc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

Timeline for d1rqpc2:

• d1rqpc2 first appeared in SCOP 1.67
  
• d1rqpc2 appears in SCOP 1.69
  
• d1rqpc2 appears in SCOP 1.73
  
• d1rqpc2 appears in the current release, SCOPe 2.08