SCOPe 2.07: Domain d1rqpc1: 1rqp C:193-298

Lineage for d1rqpc1 (1rqp C:193-298)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)

8. Domain d1rqpc1: 1rqp C:193-298 [97758]
   Other proteins in same PDB: d1rqpa2, d1rqpb2, d1rqpc2
   complexed with sam

Details for d1rqpc1

PDB Entry: 1rqp, 1.8 Å

PDB Description: Crystal structure and mechanism of a bacterial fluorinating enzyme

PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d1rqpc1:

Sequence; same for both SEQRES and ATOM records:

>d1rqpc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d1rqpc1:

• d1rqpc1 first appeared in SCOP 1.67
  
• d1rqpc1 appears in SCOPe 2.06
  
• d1rqpc1 appears in the current release, SCOPe 2.08