Lineage for d1rqpa1 (1rqp A:193-298)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383594Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 383595Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (1 family) (S)
  5. 383596Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)
  6. 383597Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)
  7. 383598Species Streptomyces cattleya [TaxId:29303] [101855] (2 PDB entries)
  8. 383599Domain d1rqpa1: 1rqp A:193-298 [97754]
    Other proteins in same PDB: d1rqpa2, d1rqpb2, d1rqpc2

Details for d1rqpa1

PDB Entry: 1rqp (more details), 1.8 Å

PDB Description: Crystal structure and mechanism of a bacterial fluorinating enzyme

SCOP Domain Sequences for d1rqpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqpa1 b.141.1.1 (A:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOP Domain Coordinates for d1rqpa1:

Click to download the PDB-style file with coordinates for d1rqpa1.
(The format of our PDB-style files is described here.)

Timeline for d1rqpa1: