SCOPe 2.08: Domain d1rqlb_: 1rql B:

Lineage for d1rqlb_ (1rql B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Phosphonoacetaldehyde hydrolase [56793] (1 species)

7. Species Bacillus cereus [TaxId:1396] [56794] (6 PDB entries)
   Uniprot O31156

8. Domain d1rqlb_: 1rql B: [97751]
   complexed with mg, vso

Details for d1rqlb_

PDB Entry: 1rql, 2.4 Å

PDB Description: Crystal Structure of Phosponoacetaldehyde Hydrolase Complexed with Magnesium and the Inhibitor Vinyl Sulfonate

PDB Compounds: (B:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d1rqlb_:

Sequence; same for both SEQRES and ATOM records:

>d1rqlb_ c.108.1.3 (B:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspinavkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehiek

Timeline for d1rqlb_:

• d1rqlb_ first appeared in SCOP 1.67
  
• d1rqlb_ appears in SCOPe 2.07