SCOPe 2.03: Domain d1rqkm_: 1rqk M:

Lineage for d1rqkm_ (1rqk M:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (55 PDB entries)
   Uniprot P02953

8. Domain d1rqkm_: 1rqk M: [97749]
   Other proteins in same PDB: d1rqkh1, d1rqkh2, d1rqkl_
   complexed with bcl, bph, cdl, fe, lda, sp2, u10

Details for d1rqkm_

PDB Entry: 1rqk, 2.7 Å

PDB Description: structure of the reaction centre from rhodobacter sphaeroides carotenoidless strain r-26.1 reconstituted with 3,4- dihydrospheroidene

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1rqkm_:

Sequence; same for both SEQRES and ATOM records:

>d1rqkm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1rqkm_:

• d1rqkm_ first appeared in SCOP 1.67
  
• d1rqkm_ appears in SCOPe 2.02
  
• d1rqkm_ appears in SCOPe 2.04
  
• d1rqkm_ appears in the current release, SCOPe 2.08