SCOPe 2.06: Domain d1rqjb_: 1rqj B:

Lineage for d1rqjb_ (1rqj B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)

7. Species Escherichia coli [TaxId:562] [101453] (2 PDB entries)

8. Domain d1rqjb_: 1rqj B: [97745]
   complexed with ipe, mg, ris

Details for d1rqjb_

PDB Entry: 1rqj, 1.95 Å

PDB Description: active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and risedronate

PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d1rqjb_:

Sequence; same for both SEQRES and ATOM records:

>d1rqjb_ a.128.1.1 (B:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]}
dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv
stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla
fsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk
tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqga
dqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk

Timeline for d1rqjb_:

• d1rqjb_ first appeared in SCOP 1.67
  
• d1rqjb_ appears in SCOPe 2.05
  
• d1rqjb_ appears in SCOPe 2.07
  
• d1rqjb_ appears in the current release, SCOPe 2.08