Lineage for d1rqjb_ (1rqj B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1281956Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 1281957Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)
  7. 1281964Species Escherichia coli [TaxId:562] [101453] (2 PDB entries)
  8. 1281966Domain d1rqjb_: 1rqj B: [97745]
    complexed with ipe, mg, ris

Details for d1rqjb_

PDB Entry: 1rqj (more details), 1.95 Å

PDB Description: active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and risedronate
PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d1rqjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqjb_ a.128.1.1 (B:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]}
dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv
stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla
fsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk
tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqga
dqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk

SCOPe Domain Coordinates for d1rqjb_:

Click to download the PDB-style file with coordinates for d1rqjb_.
(The format of our PDB-style files is described here.)

Timeline for d1rqjb_: