Lineage for d1rqcf_ (1rqc F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3000944Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 3000945Protein Peptide deformylase [56422] (11 species)
  7. 3001008Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries)
  8. 3001016Domain d1rqcf_: 1rqc F: [97737]
    Other proteins in same PDB: d1rqca2, d1rqcb2, d1rqce2
    complexed with co

Details for d1rqcf_

PDB Entry: 1rqc (more details), 2.8 Å

PDB Description: Crystals of peptide deformylase from Plasmodium falciparum with ten subunits per asymmetric unit reveal critical characteristics of the active site for drug design
PDB Compounds: (F:) formylmethionine deformylase

SCOPe Domain Sequences for d1rqcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqcf_ d.167.1.1 (F:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathse

SCOPe Domain Coordinates for d1rqcf_:

Click to download the PDB-style file with coordinates for d1rqcf_.
(The format of our PDB-style files is described here.)

Timeline for d1rqcf_: