Lineage for d1rq5a2 (1rq5 A:208-305)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456196Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 456212Protein Cellulose 1,4-beta-cellobiosidase CbhA, precatalytic domain [101521] (1 species)
  7. 456213Species Clostridium thermocellum [TaxId:1515] [101522] (2 PDB entries)
  8. 456215Domain d1rq5a2: 1rq5 A:208-305 [97731]
    Other proteins in same PDB: d1rq5a1

Details for d1rq5a2

PDB Entry: 1rq5 (more details), 2.4 Å

PDB Description: structural basis for the exocellulase activity of the cellobiohydrolase cbha from c. thermocellum

SCOP Domain Sequences for d1rq5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rq5a2 b.1.18.2 (A:208-305) Cellulose 1,4-beta-cellobiosidase CbhA, precatalytic domain {Clostridium thermocellum}
ilpqpdvrvnqvgylpegkkvatvvcnstqpvkwqlknaagvvvlegytepkgldkdsqd
yvhwldfsdfategigyyfelptvnsptnyshpfdirk

SCOP Domain Coordinates for d1rq5a2:

Click to download the PDB-style file with coordinates for d1rq5a2.
(The format of our PDB-style files is described here.)

Timeline for d1rq5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rq5a1