Lineage for d1rpza2 (1rpz A:1-152)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393333Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 393486Protein Polynucleotide kinase, kinase domain [75191] (1 species)
  7. 393487Species Bacteriophage T4 [TaxId:10665] [75192] (5 PDB entries)
  8. 393492Domain d1rpza2: 1rpz A:1-152 [97721]
    Other proteins in same PDB: d1rpza1
    complexed with adp, ca, dms

Details for d1rpza2

PDB Entry: 1rpz (more details), 2.9 Å

PDB Description: t4 polynucleotide kinase bound to 5'-tgcac-3' ssdna
PDB Compounds: (A:)

SCOP Domain Sequences for d1rpza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpza2 c.37.1.1 (A:1-152) Polynucleotide kinase, kinase domain {Bacteriophage T4}
mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
krnskrgtkavpidvlrsmyksmreylglpvy

SCOP Domain Coordinates for d1rpza2:

Click to download the PDB-style file with coordinates for d1rpza2.
(The format of our PDB-style files is described here.)

Timeline for d1rpza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rpza1