Lineage for d1rpyb_ (1rpy B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415905Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 415906Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 415907Family d.93.1.1: SH2 domain [55551] (28 proteins)
  6. 415915Protein Adaptor protein Aps [103139] (1 species)
  7. 415916Species Rat (Rattus norvegicus) [TaxId:10116] [103140] (2 PDB entries)
  8. 415918Domain d1rpyb_: 1rpy B: [97719]
    complexed with so4

Details for d1rpyb_

PDB Entry: 1rpy (more details), 2.3 Å

PDB Description: crystal structure of the dimeric sh2 domain of aps

SCOP Domain Sequences for d1rpyb_:

Sequence, based on SEQRES records: (download)

>d1rpyb_ d.93.1.1 (B:) Adaptor protein Aps {Rat (Rattus norvegicus)}
lsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlsl
nghgqchvqhlwfqsvfdmlrhfhthpipl

Sequence, based on observed residues (ATOM records): (download)

>d1rpyb_ d.93.1.1 (B:) Adaptor protein Aps {Rat (Rattus norvegicus)}
lsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlsg
qchvqhlwfqsvfdmlrhfhthpipl

SCOP Domain Coordinates for d1rpyb_:

Click to download the PDB-style file with coordinates for d1rpyb_.
(The format of our PDB-style files is described here.)

Timeline for d1rpyb_: