Lineage for d1rpya_ (1rpy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965237Protein Adaptor protein Aps [103139] (1 species)
  7. 2965238Species Norway rat (Rattus norvegicus) [TaxId:10116] [103140] (2 PDB entries)
  8. 2965239Domain d1rpya_: 1rpy A: [97718]
    complexed with so4

Details for d1rpya_

PDB Entry: 1rpy (more details), 2.3 Å

PDB Description: crystal structure of the dimeric sh2 domain of aps
PDB Compounds: (A:) adaptor protein APS

SCOPe Domain Sequences for d1rpya_:

Sequence, based on SEQRES records: (download)

>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Norway rat (Rattus norvegicus) [TaxId: 10116]}
elsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrls
lnghgqchvqhlwfqsvfdmlrhfht

Sequence, based on observed residues (ATOM records): (download)

>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Norway rat (Rattus norvegicus) [TaxId: 10116]}
elsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlh
gqchvqhlwfqsvfdmlrhfht

SCOPe Domain Coordinates for d1rpya_:

Click to download the PDB-style file with coordinates for d1rpya_.
(The format of our PDB-style files is described here.)

Timeline for d1rpya_: