SCOPe 2.07: Domain d1rpua_: 1rpu A:

Lineage for d1rpua_ (1rpu A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.255: Tombusvirus P19 core protein, VP19 [103144] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel sheet: order 2134

4. Superfamily d.255.1: Tombusvirus P19 core protein, VP19 [103145] (1 family)

5. Family d.255.1.1: Tombusvirus P19 core protein, VP19 [103146] (2 proteins)

6. Protein Tombusvirus P19 core protein, VP19 [103147] (2 species)
   an RNA silencing suppressor

7. Species Carnation italian ringspot virus, CIRV [TaxId:39443] [103149] (1 PDB entry)

8. Domain d1rpua_: 1rpu A: [97716]
   complexed with siRNA
   protein/RNA complex

Details for d1rpua_

PDB Entry: 1rpu, 2.5 Å

PDB Description: crystal structure of cirv p19 bound to sirna

PDB Compounds: (A:) 19 kDa protein

SCOPe Domain Sequences for d1rpua_:

Sequence, based on SEQRES records:

>d1rpua_ d.255.1.1 (A:) Tombusvirus P19 core protein, VP19 {Carnation italian ringspot virus, CIRV [TaxId: 39443]}
ndtreqangerwdggsggitspfklpdespswtewrlyndetnsnqdnplgfkeswgfgk
vvfkrylrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvsvtisggs
rtlqhlcemairskqellqltpvev

Sequence, based on observed residues (ATOM records):

>d1rpua_ d.255.1.1 (A:) Tombusvirus P19 core protein, VP19 {Carnation italian ringspot virus, CIRV [TaxId: 39443]}
ndtreqangerwdggsggitspfklpdespswtewrlyndenplgfkeswgfgkvvfkry
lrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvsvtisggsrtlqhl
cemairskqellqltpvev

Timeline for d1rpua_:

• d1rpua_ first appeared in SCOP 1.67
  
• d1rpua_ appears in SCOPe 2.06
  
• d1rpua_ appears in the current release, SCOPe 2.08