Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.255: Tombusvirus P19 core protein, VP19 [103144] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel sheet: order 2134 |
Superfamily d.255.1: Tombusvirus P19 core protein, VP19 [103145] (1 family) |
Family d.255.1.1: Tombusvirus P19 core protein, VP19 [103146] (2 proteins) |
Protein Tombusvirus P19 core protein, VP19 [103147] (2 species) an RNA silencing suppressor |
Species Carnation italian ringspot virus, CIRV [TaxId:39443] [103149] (1 PDB entry) |
Domain d1rpua_: 1rpu A: [97716] complexed with siRNA protein/RNA complex |
PDB Entry: 1rpu (more details), 2.5 Å
SCOPe Domain Sequences for d1rpua_:
Sequence, based on SEQRES records: (download)
>d1rpua_ d.255.1.1 (A:) Tombusvirus P19 core protein, VP19 {Carnation italian ringspot virus, CIRV [TaxId: 39443]} ndtreqangerwdggsggitspfklpdespswtewrlyndetnsnqdnplgfkeswgfgk vvfkrylrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvsvtisggs rtlqhlcemairskqellqltpvev
>d1rpua_ d.255.1.1 (A:) Tombusvirus P19 core protein, VP19 {Carnation italian ringspot virus, CIRV [TaxId: 39443]} ndtreqangerwdggsggitspfklpdespswtewrlyndenplgfkeswgfgkvvfkry lrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvsvtisggsrtlqhl cemairskqellqltpvev
Timeline for d1rpua_: