Lineage for d1rpua_ (1rpu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008959Fold d.255: Tombusvirus P19 core protein, VP19 [103144] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel sheet: order 2134
  4. 3008960Superfamily d.255.1: Tombusvirus P19 core protein, VP19 [103145] (1 family) (S)
  5. 3008961Family d.255.1.1: Tombusvirus P19 core protein, VP19 [103146] (2 proteins)
  6. 3008962Protein Tombusvirus P19 core protein, VP19 [103147] (2 species)
    an RNA silencing suppressor
  7. 3008963Species Carnation italian ringspot virus, CIRV [TaxId:39443] [103149] (1 PDB entry)
  8. 3008964Domain d1rpua_: 1rpu A: [97716]
    complexed with siRNA
    protein/RNA complex

Details for d1rpua_

PDB Entry: 1rpu (more details), 2.5 Å

PDB Description: crystal structure of cirv p19 bound to sirna
PDB Compounds: (A:) 19 kDa protein

SCOPe Domain Sequences for d1rpua_:

Sequence, based on SEQRES records: (download)

>d1rpua_ d.255.1.1 (A:) Tombusvirus P19 core protein, VP19 {Carnation italian ringspot virus, CIRV [TaxId: 39443]}
ndtreqangerwdggsggitspfklpdespswtewrlyndetnsnqdnplgfkeswgfgk
vvfkrylrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvsvtisggs
rtlqhlcemairskqellqltpvev

Sequence, based on observed residues (ATOM records): (download)

>d1rpua_ d.255.1.1 (A:) Tombusvirus P19 core protein, VP19 {Carnation italian ringspot virus, CIRV [TaxId: 39443]}
ndtreqangerwdggsggitspfklpdespswtewrlyndenplgfkeswgfgkvvfkry
lrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvsvtisggsrtlqhl
cemairskqellqltpvev

SCOPe Domain Coordinates for d1rpua_:

Click to download the PDB-style file with coordinates for d1rpua_.
(The format of our PDB-style files is described here.)

Timeline for d1rpua_: