Lineage for d1rpnd_ (1rpn D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827751Protein GDP-mannose 4,6-dehydratase [51759] (4 species)
  7. 1827759Species Pseudomonas aeruginosa [TaxId:287] [102134] (1 PDB entry)
  8. 1827763Domain d1rpnd_: 1rpn D: [97711]
    complexed with gdp, ndp

Details for d1rpnd_

PDB Entry: 1rpn (more details), 2.15 Å

PDB Description: Crystal Structure of GDP-D-mannose 4,6-dehydratase in complexes with GDP and NADPH
PDB Compounds: (D:) GDP-mannose 4,6-dehydratase

SCOPe Domain Sequences for d1rpnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpnd_ c.2.1.2 (D:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]}
trsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelgiegdiqyedgdma
dacsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthlleairqfspetrf
yqastsemfgliqaerqdentpfyprspygvaklyghwitvnyresfglhassgilfnhe
splrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyveamwlmlqqdkadd
yvvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllgnpakaqrvlgwkp
rtsldelirmmveadlrrvsre

SCOPe Domain Coordinates for d1rpnd_:

Click to download the PDB-style file with coordinates for d1rpnd_.
(The format of our PDB-style files is described here.)

Timeline for d1rpnd_: