Lineage for d1rp7b3 (1rp7 B:701-886)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855607Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1855608Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1855609Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 1855610Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 1855611Species Escherichia coli [TaxId:562] [75240] (8 PDB entries)
  8. 1855625Domain d1rp7b3: 1rp7 B:701-886 [97707]
    Other proteins in same PDB: d1rp7a1, d1rp7a2, d1rp7b1, d1rp7b2
    complexed with mg, tzd

Details for d1rp7b3

PDB Entry: 1rp7 (more details), 2.09 Å

PDB Description: e. coli pyruvate dehydrogenase inhibitor complex
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d1rp7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp7b3 c.48.1.1 (B:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOPe Domain Coordinates for d1rp7b3:

Click to download the PDB-style file with coordinates for d1rp7b3.
(The format of our PDB-style files is described here.)

Timeline for d1rp7b3: