| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.6: TK-like Pyr module [88735] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
| Protein Pyruvate dehydrogenase E1 component, Pyr module [88739] (1 species) E1A and E1B fused together in a single-chain protein |
| Species Escherichia coli [TaxId:562] [88740] (6 PDB entries) |
| Domain d1rp7b1: 1rp7 B:471-700 [97705] Other proteins in same PDB: d1rp7a2, d1rp7a3, d1rp7b2, d1rp7b3 complexed with mg, tzd |
PDB Entry: 1rp7 (more details), 2.09 Å
SCOPe Domain Sequences for d1rp7b1:
Sequence, based on SEQRES records: (download)
>d1rp7b1 c.36.1.6 (B:471-700) Pyruvate dehydrogenase E1 component, Pyr module {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa
>d1rp7b1 c.36.1.6 (B:471-700) Pyruvate dehydrogenase E1 component, Pyr module {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa
Timeline for d1rp7b1: