SCOP 1.69: Domain d1rp5b2: 1rp5 B:693-750

Lineage for d1rp5b2 (1rp5 B:693-750)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
   alpha1-beta3; 2 layers: alpha/beta; order 132

4. Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family)
   duplication: consists of 2 subdomains of this fold

5. Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)

6. Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [54187] (6 PDB entries)

8. Domain d1rp5b2: 1rp5 B:693-750 [97699]
   Other proteins in same PDB: d1rp5a3, d1rp5a4, d1rp5b3, d1rp5b4

Details for d1rp5b2

PDB Entry: 1rp5, 3 Å

PDB Description: PBP2x from Streptococcus pneumoniae strain 5259 with reduced susceptibility to beta-lactam antibiotics

SCOP Domain Sequences for d1rp5b2:

Sequence; same for both SEQRES and ATOM records:

>d1rp5b2 d.11.1.1 (B:693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae}
aeevpdmygwtketaetfakwlnielefegsgstvqkqdvrantaikdikkikltlgd

Timeline for d1rp5b2:

• d1rp5b2 first appeared in SCOP 1.67
  
• d1rp5b2 appears in SCOP 1.71
  
• d1rp5b2 appears in the current release, SCOPe 2.08