Lineage for d1rp5a4 (1rp5 A:264-631)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450617Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)
  7. 1450618Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)
  8. 1450630Domain d1rp5a4: 1rp5 A:264-631 [97697]
    Other proteins in same PDB: d1rp5a1, d1rp5a2, d1rp5a3, d1rp5b1, d1rp5b2, d1rp5b3
    complexed with so4

Details for d1rp5a4

PDB Entry: 1rp5 (more details), 3 Å

PDB Description: PBP2x from Streptococcus pneumoniae strain 5259 with reduced susceptibility to beta-lactam antibiotics
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d1rp5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp5a4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niamsafgqgisvtqtqmlraftaiandgvmlepkfisalydpndqsvrksqkeivgnpv
skeaasvtrdhmvmvgtdptygtmynhstgkatvnvpgqnvalksgtaeiadeknggylt
gstnnifsvvsmhpaenpdfilyvtvqqpehysgiqlgefanpilerasamkeslnlqtt
akaleqvs

SCOPe Domain Coordinates for d1rp5a4:

Click to download the PDB-style file with coordinates for d1rp5a4.
(The format of our PDB-style files is described here.)

Timeline for d1rp5a4: