Lineage for d1rp3h_ (1rp3 H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750858Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1751065Superfamily a.137.11: Anti-sigma factor FlgM [101498] (1 family) (S)
  5. 1751066Family a.137.11.1: Anti-sigma factor FlgM [101499] (1 protein)
  6. 1751067Protein Anti-sigma factor FlgM [101500] (1 species)
  7. 1751068Species Aquifex aeolicus [TaxId:63363] [101501] (2 PDB entries)
  8. 1751072Domain d1rp3h_: 1rp3 H: [97693]
    Other proteins in same PDB: d1rp3a1, d1rp3a2, d1rp3a3, d1rp3c1, d1rp3c2, d1rp3c3, d1rp3e1, d1rp3e2, d1rp3e3, d1rp3g1, d1rp3g2, d1rp3g3

Details for d1rp3h_

PDB Entry: 1rp3 (more details), 2.3 Å

PDB Description: cocrystal structure of the flagellar sigma/anti-sigma complex, sigma- 28/flgm
PDB Compounds: (H:) anti sigma factor FlgM

SCOPe Domain Sequences for d1rp3h_:

Sequence, based on SEQRES records: (download)

>d1rp3h_ a.137.11.1 (H:) Anti-sigma factor FlgM {Aquifex aeolicus [TaxId: 63363]}
mvnrielsrligllletekrknteqkesgtnkiedkvtlskiaqelskndveekdlekkv
kelkekiekgeyevsdekvvkgliefft

Sequence, based on observed residues (ATOM records): (download)

>d1rp3h_ a.137.11.1 (H:) Anti-sigma factor FlgM {Aquifex aeolicus [TaxId: 63363]}
mvnrielsrligllletekrkdkvtlskiaqelskndlekkvkelkekiekgeyevsdek
vvkgliefft

SCOPe Domain Coordinates for d1rp3h_:

Click to download the PDB-style file with coordinates for d1rp3h_.
(The format of our PDB-style files is described here.)

Timeline for d1rp3h_: