Lineage for d1rp3c3 (1rp3 C:2-86)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779761Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 779762Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 779763Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 779768Protein Sigma factor sigma-28 (FliA) [101383] (1 species)
  7. 779769Species Aquifex aeolicus [TaxId:63363] [101384] (2 PDB entries)
  8. 779771Domain d1rp3c3: 1rp3 C:2-86 [97684]
    Other proteins in same PDB: d1rp3a1, d1rp3a2, d1rp3b_, d1rp3c1, d1rp3c2, d1rp3d_, d1rp3e1, d1rp3e2, d1rp3f_, d1rp3g1, d1rp3g2, d1rp3h_

Details for d1rp3c3

PDB Entry: 1rp3 (more details), 2.3 Å

PDB Description: cocrystal structure of the flagellar sigma/anti-sigma complex, sigma- 28/flgm
PDB Compounds: (C:) RNA polymerase sigma factor SIGMA-28 (FliA)

SCOP Domain Sequences for d1rp3c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp3c3 a.177.1.1 (C:2-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}
knpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlsten
pkraeayiklrikgaiydylrsldf

SCOP Domain Coordinates for d1rp3c3:

Click to download the PDB-style file with coordinates for d1rp3c3.
(The format of our PDB-style files is described here.)

Timeline for d1rp3c3: