SCOP 1.71: Domain d1rowb_: 1row B:

Lineage for d1rowb_ (1row B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam 00635

6. Protein SSP-19 [101540] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [101541] (1 PDB entry)
   C55C2.2 gene product

8. Domain d1rowb_: 1row B: [97677]

Details for d1rowb_

PDB Entry: 1row, 2 Å

PDB Description: structure of ssp-19, an msp-domain protein like family member in caenorhabditis elegans

SCOP Domain Sequences for d1rowb_:

Sequence; same for both SEQRES and ATOM records:

>d1rowb_ b.1.11.2 (B:) SSP-19 {Nematode (Caenorhabditis elegans)}
ltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvi
trtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata

Timeline for d1rowb_:

• d1rowb_ first appeared in SCOP 1.67
  
• d1rowb_ appears in SCOP 1.69
  
• d1rowb_ appears in SCOP 1.73
  
• d1rowb_ appears in the current release, SCOPe 2.08