Lineage for d1rowb_ (1row B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367578Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 367625Family b.1.11.2: MSP-like [49360] (3 proteins)
  6. 367645Protein SSP-19 [101540] (1 species)
  7. 367646Species Nematode (Caenorhabditis elegans) [TaxId:6239] [101541] (1 PDB entry)
    C55C2.2 gene product
  8. 367648Domain d1rowb_: 1row B: [97677]

Details for d1rowb_

PDB Entry: 1row (more details), 2 Å

PDB Description: structure of ssp-19, an msp-domain protein like family member in caenorhabditis elegans

SCOP Domain Sequences for d1rowb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rowb_ b.1.11.2 (B:) SSP-19 {Nematode (Caenorhabditis elegans)}
ltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvi
trtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata

SCOP Domain Coordinates for d1rowb_:

Click to download the PDB-style file with coordinates for d1rowb_.
(The format of our PDB-style files is described here.)

Timeline for d1rowb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rowa_