| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
| Family b.1.11.2: MSP-like [49360] (4 proteins) Pfam PF00635 |
| Protein SSP-19 [101540] (1 species) |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [101541] (1 PDB entry) C55C2.2 gene product |
| Domain d1rowb_: 1row B: [97677] |
PDB Entry: 1row (more details), 2 Å
SCOPe Domain Sequences for d1rowb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rowb_ b.1.11.2 (B:) SSP-19 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvi
trtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata
Timeline for d1rowb_: