Lineage for d1rowb_ (1row B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764689Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 2764716Protein SSP-19 [101540] (1 species)
  7. 2764717Species Nematode (Caenorhabditis elegans) [TaxId:6239] [101541] (1 PDB entry)
    C55C2.2 gene product
  8. 2764719Domain d1rowb_: 1row B: [97677]

Details for d1rowb_

PDB Entry: 1row (more details), 2 Å

PDB Description: structure of ssp-19, an msp-domain protein like family member in caenorhabditis elegans
PDB Compounds: (B:) MSP-domain protein like family member

SCOPe Domain Sequences for d1rowb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rowb_ b.1.11.2 (B:) SSP-19 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvi
trtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata

SCOPe Domain Coordinates for d1rowb_:

Click to download the PDB-style file with coordinates for d1rowb_.
(The format of our PDB-style files is described here.)

Timeline for d1rowb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rowa_