Lineage for d1rova2 (1rov A:9-167)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304668Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 1304669Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 1304670Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 1304676Protein Plant lipoxigenase [49725] (2 species)
  7. 1304693Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (9 PDB entries)
    Uniprot P09186
  8. 1304700Domain d1rova2: 1rov A:9-167 [97675]
    Other proteins in same PDB: d1rova1
    complexed with fe

Details for d1rova2

PDB Entry: 1rov (more details), 2 Å

PDB Description: Lipoxygenase-3 Treated with Cumene Hydroperoxide
PDB Compounds: (A:) Seed lipoxygenase-3

SCOPe Domain Sequences for d1rova2:

Sequence, based on SEQRES records: (download)

>d1rova2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
sltledipnhgsihfvcnswiynaklfksdriffanqty

Sequence, based on observed residues (ATOM records): (download)

>d1rova2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
ghkikgtvvlmrknvldvnsvtsvtldtltaflgrsvslqlisatkadangkgklgkatf
legiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflvsltledipnhgsi
hfvcnswiynaklfksdriffanqty

SCOPe Domain Coordinates for d1rova2:

Click to download the PDB-style file with coordinates for d1rova2.
(The format of our PDB-style files is described here.)

Timeline for d1rova2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rova1