Lineage for d1rova1 (1rov A:168-857)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360228Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 360229Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 360230Family a.119.1.1: Plant lipoxigenases [48485] (1 protein)
  6. 360231Protein Lipoxigenase, C-terminal domain [48486] (2 species)
    N-terminal domain is beta-sandwich similar to colipase-binding domain of pancreatic lipase
    contains alpha plus beta subdomain: res. 341-495; alpha-beta(5)-alpha
  7. 360241Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [48488] (7 PDB entries)
  8. 360247Domain d1rova1: 1rov A:168-857 [97674]
    Other proteins in same PDB: d1rova2
    complexed with fe, hlu

Details for d1rova1

PDB Entry: 1rov (more details), 2 Å

PDB Description: Lipoxygenase-3 Treated with Cumene Hydroperoxide

SCOP Domain Sequences for d1rova1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rova1 a.119.1.1 (A:168-857) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L3}
lpsetpaplvkyreeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggn
dtfpyprrgrtgrkptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpl
lqsafdlnftprefdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpp
pkviqvsksawmtdeefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehle
pnlegltvdeaiqnkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplai
elslphpqgdqsgafsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavve
pfiiatnrhlsvvhpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsa
vvykdwvftdqalpadlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvhey
vflyyksddtlredpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasa
lhaavnfgqypygglilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidl
svieilsrhasdevylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnr
cgpvqmpytlllpsskegltfrgipnsisi

SCOP Domain Coordinates for d1rova1:

Click to download the PDB-style file with coordinates for d1rova1.
(The format of our PDB-style files is described here.)

Timeline for d1rova1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rova2