Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (1 family) contains extra C-terminal strand automatically mapped to Pfam PF04729 |
Family b.1.22.1: ASF1-like [101547] (2 proteins) |
Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (3 PDB entries) |
Domain d1roca1: 1roc A:2-154 [97673] Other proteins in same PDB: d1roca2 complexed with br |
PDB Entry: 1roc (more details), 1.5 Å
SCOPe Domain Sequences for d1roca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1roca1 b.1.22.1 (A:2-154) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee lrenppakvqvdhivrnilaekprvtrfnivwd
Timeline for d1roca1: