SCOPe 2.06: Domain d1roca1: 1roc A:2-154

Lineage for d1roca1 (1roc A:2-154)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (1 family)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein Anti-silencing protein 1, ASF1 [101548] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (3 PDB entries)

8. Domain d1roca1: 1roc A:2-154 [97673]
   Other proteins in same PDB: d1roca2
   complexed with br

Details for d1roca1

PDB Entry: 1roc, 1.5 Å

PDB Description: Crystal structure of the histone deposition protein Asf1

PDB Compounds: (A:) Anti-silencing protein 1

SCOPe Domain Sequences for d1roca1:

Sequence; same for both SEQRES and ATOM records:

>d1roca1 b.1.22.1 (A:2-154) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwd

Timeline for d1roca1:

• d1roca1 first appeared in SCOP 1.67, called d1roca_
  
• d1roca1 was called d1roca_ in SCOPe 2.05
  
• d1roca1 appears in SCOPe 2.07
  
• d1roca1 appears in the current release, SCOPe 2.08