SCOP 1.69: Domain d1roca_: 1roc A:

Lineage for d1roca_ (1roc A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (1 family)
   contains extra C-terminal strand

5. Family b.1.22.1: ASF1-like [101547] (1 protein)

6. Protein Anti-silencing protein 1, ASF1 [101548] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (1 PDB entry)

8. Domain d1roca_: 1roc A: [97673]

Details for d1roca_

PDB Entry: 1roc, 1.5 Å

PDB Description: Crystal structure of the histone deposition protein Asf1

SCOP Domain Sequences for d1roca_:

Sequence; same for both SEQRES and ATOM records:

>d1roca_ b.1.22.1 (A:) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae)}
gasivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqelds
ilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneyde
eelrenppakvqvdhivrnilaekprvtrfnivwd

Timeline for d1roca_:

• d1roca_ first appeared in SCOP 1.67
  
• d1roca_ appears in SCOP 1.71
  
• d1roca_ appears in the current release, SCOPe 2.08, called d1roca1