Lineage for d1ro8b_ (1ro8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151564Fold c.130: Alpha-2,3/8-sialyltransferase CstII [102413] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 8 strands, order 54321678
  4. 2151565Superfamily c.130.1: Alpha-2,3/8-sialyltransferase CstII [102414] (2 families) (S)
  5. 2151566Family c.130.1.1: Alpha-2,3/8-sialyltransferase CstII [102415] (2 protein domains)
    automatically mapped to Pfam PF06002
  6. 2151567Protein Alpha-2,3/8-sialyltransferase CstII [102416] (1 species)
  7. 2151568Species Campylobacter jejuni [TaxId:197] [102417] (5 PDB entries)
  8. 2151578Domain d1ro8b_: 1ro8 B: [97672]
    Other proteins in same PDB: d1ro8a2
    complexed with c5p

Details for d1ro8b_

PDB Entry: 1ro8 (more details), 2.05 Å

PDB Description: Structural analysis of the sialyltransferase CstII from Campylobacter jejuni in complex with a substrate analogue, cytidine-5'-monophosphate
PDB Compounds: (B:) Alpha-2,3/8-sialyltransferase

SCOPe Domain Sequences for d1ro8b_:

Sequence, based on SEQRES records: (download)

>d1ro8b_ c.130.1.1 (B:) Alpha-2,3/8-sialyltransferase CstII {Campylobacter jejuni [TaxId: 197]}
mkkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyy
tlkhliqnqeyetelimcsnynqahlenenfvktfydyfpdahlgydffkqlkdfnayfk
fheiyfnqritsgvymcavaialgykeiylsgidfyqngssyafdtkqknllklapnfkn
dnshyighskntdikaleflektykiklyclcpnsllanfiglapnlnsnfiiqeknnyt
kdilipsseaygkfskn

Sequence, based on observed residues (ATOM records): (download)

>d1ro8b_ c.130.1.1 (B:) Alpha-2,3/8-sialyltransferase CstII {Campylobacter jejuni [TaxId: 197]}
mkkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyy
tlkhliqnqeyetelimcsnynqahlenenfvktfydyfpdahlgydffkqlkdfnayfk
fheiyfnqritsgvymcavaialgykeiylsgidfykntdikaleflektykiklyclcp
nsllanfiglapnlnsnfiiqeknnytkdilipsseaygkfskn

SCOPe Domain Coordinates for d1ro8b_:

Click to download the PDB-style file with coordinates for d1ro8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ro8b_: