Lineage for d1rm8a_ (1rm8 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415641Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 415710Protein Matrix metalloproteinase-16 (MMP-16) [103130] (1 species)
  7. 415711Species Human (Homo sapiens) [TaxId:9606] [103131] (1 PDB entry)
  8. 415712Domain d1rm8a_: 1rm8 A: [97660]
    complexed with bat, ca, zn

Details for d1rm8a_

PDB Entry: 1rm8 (more details), 1.8 Å

PDB Description: crystal structure of the catalytic domain of mmp-16/mt3-mmp: characterization of mt-mmp specific features

SCOP Domain Sequences for d1rm8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens)}
gqkwqhkhitysiknvtpkvgdpetrkairrafdvwqnvtpltfeevpyselengkrdvd
itiifasgfhgdsspfdgeggflahayfpgpgiggdthfdsdepwtlgnpnhdgndlflv
avhelghalglehsndptaimapfyqymetdnfklpnddlqgiqkiygp

SCOP Domain Coordinates for d1rm8a_:

Click to download the PDB-style file with coordinates for d1rm8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rm8a_: