Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) |
Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins) |
Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species) duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103074] (3 PDB entries) |
Domain d1rlva3: 1rlv A:2-60 [97654] Other proteins in same PDB: d1rlva1, d1rlva2, d1rlvb1, d1rlvb2 |
PDB Entry: 1rlv (more details), 3 Å
SCOP Domain Sequences for d1rlva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlva3 d.75.1.1 (A:2-60) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeon Archaeoglobus fulgidus} iggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
Timeline for d1rlva3:
View in 3D Domains from other chains: (mouse over for more information) d1rlvb1, d1rlvb2, d1rlvb3, d1rlvb4 |