Lineage for d1rlva2 (1rlv A:215-305)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490815Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) (S)
  5. 2490816Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins)
  6. 2490817Protein Dimeric tRNA splicing endonuclease, domains 2 and 4 [102477] (1 species)
    duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats
  7. 2490818Species Archaeoglobus fulgidus [TaxId:2234] [102478] (4 PDB entries)
  8. 2490840Domain d1rlva2: 1rlv A:215-305 [97653]
    Other proteins in same PDB: d1rlva3, d1rlva4, d1rlvb3, d1rlvb4

Details for d1rlva2

PDB Entry: 1rlv (more details), 3 Å

PDB Description: Crystal structure of a dimeric Archaeal Splicing Endonuclease
PDB Compounds: (A:) Putative tRNA-intron endonuclease

SCOPe Domain Sequences for d1rlva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlva2 c.52.2.1 (A:215-305) Dimeric tRNA splicing endonuclease, domains 2 and 4 {Archaeoglobus fulgidus [TaxId: 2234]}
nfdrryevyrnlkergfvvktgfkfgsefrvyrkvesvddlphseylvdiadsreirlid
laravrlaqnvrkrmvfaygknylcfervkv

SCOPe Domain Coordinates for d1rlva2:

Click to download the PDB-style file with coordinates for d1rlva2.
(The format of our PDB-style files is described here.)

Timeline for d1rlva2: