Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) |
Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins) |
Protein Dimeric tRNA splicing endonuclease, domains 2 and 4 [102477] (1 species) duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats |
Species Archaeoglobus fulgidus [TaxId:2234] [102478] (4 PDB entries) |
Domain d1rlva2: 1rlv A:215-305 [97653] Other proteins in same PDB: d1rlva3, d1rlva4, d1rlvb3, d1rlvb4 |
PDB Entry: 1rlv (more details), 3 Å
SCOPe Domain Sequences for d1rlva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlva2 c.52.2.1 (A:215-305) Dimeric tRNA splicing endonuclease, domains 2 and 4 {Archaeoglobus fulgidus [TaxId: 2234]} nfdrryevyrnlkergfvvktgfkfgsefrvyrkvesvddlphseylvdiadsreirlid laravrlaqnvrkrmvfaygknylcfervkv
Timeline for d1rlva2:
View in 3D Domains from other chains: (mouse over for more information) d1rlvb1, d1rlvb2, d1rlvb3, d1rlvb4 |