Lineage for d1rlka_ (1rlk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923056Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 2923057Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) (S)
  5. 2923058Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins)
    Pfam PF01981; UPF0099
  6. 2923070Protein Hypothetical protein TA0108 [102466] (1 species)
  7. 2923071Species Thermoplasma acidophilum [TaxId:2303] [102467] (1 PDB entry)
  8. 2923072Domain d1rlka_: 1rlk A: [97651]
    complexed with gol, so4

Details for d1rlka_

PDB Entry: 1rlk (more details), 1.95 Å

PDB Description: Structure of Conserved Protein of Unknown Function TA0108 from Thermoplasma acidophilum
PDB Compounds: (A:) Hypothetical protein Ta0108

SCOPe Domain Sequences for d1rlka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlka_ c.131.1.1 (A:) Hypothetical protein TA0108 {Thermoplasma acidophilum [TaxId: 2303]}
vkkmviavrkdldmgkgkiaaqvahaavtcairsmkinrdvfnewydegqrkivvkvndl
deimeikrmadsmgivneivqdrgytqvepgtitciglgpdeeekldkitgkykll

SCOPe Domain Coordinates for d1rlka_:

Click to download the PDB-style file with coordinates for d1rlka_.
(The format of our PDB-style files is described here.)

Timeline for d1rlka_: