SCOPe 2.05: Domain d1rlia_: 1rli A:

Lineage for d1rlia_ (1rli A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.6: Hypothetical protein YwqN [102237] (1 protein)
   automatically mapped to Pfam PF03358
   automatically mapped to Pfam PF02525

6. Protein Hypothetical protein YwqN [102238] (1 species)
   Trp repressor binding protein

7. Species Bacillus subtilis [TaxId:1423] [102239] (1 PDB entry)

8. Domain d1rlia_: 1rli A: [97647]
   complexed with po4, pt

Details for d1rlia_

PDB Entry: 1rli, 1.8 Å

PDB Description: The Structure of Trp Repressor Binding Protein from Bacillus subtilis

PDB Compounds: (A:) Trp Repressor Binding Protein

SCOPe Domain Sequences for d1rlia_:

Sequence, based on SEQRES records:

>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]}
kiavinggtrsggntdvlaekavqgfdaehiylqkypiqpiedlrhaqggfrpvqddyds
iierilqchilifatpiywfgmsgtlklfidrwsqtlrdprfpdfkqqmsvkqayviavg
gdnpkikglpliqqfehifhfmgmsfkgyvlgegnrpgdilrdhqalsaasrllkrsda

Sequence, based on observed residues (ATOM records):

>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]}
kiavinggtrsggntdvlaekavqgfdaehiyldydsiierilqchilifatpiywfgms
gtlklfidrwsqtlrdprfpdfkqqmsvkqayviavggdnpkikglpliqqfehifhfmg
msfkgyvlgegnrpgdilrdhqalsaasrllkrsda

Timeline for d1rlia_:

• d1rlia_ first appeared in SCOP 1.67
  
• d1rlia_ appears in SCOPe 2.04
  
• d1rlia_ appears in SCOPe 2.06
  
• d1rlia_ appears in the current release, SCOPe 2.08