Lineage for d1rlia_ (1rli A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856837Family c.23.5.6: Hypothetical protein YwqN [102237] (1 protein)
    automatically mapped to Pfam PF03358
    automatically mapped to Pfam PF02525
  6. 2856838Protein Hypothetical protein YwqN [102238] (1 species)
    Trp repressor binding protein
  7. 2856839Species Bacillus subtilis [TaxId:1423] [102239] (1 PDB entry)
  8. 2856840Domain d1rlia_: 1rli A: [97647]
    complexed with po4, pt

Details for d1rlia_

PDB Entry: 1rli (more details), 1.8 Å

PDB Description: The Structure of Trp Repressor Binding Protein from Bacillus subtilis
PDB Compounds: (A:) Trp Repressor Binding Protein

SCOPe Domain Sequences for d1rlia_:

Sequence, based on SEQRES records: (download)

>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]}
kiavinggtrsggntdvlaekavqgfdaehiylqkypiqpiedlrhaqggfrpvqddyds
iierilqchilifatpiywfgmsgtlklfidrwsqtlrdprfpdfkqqmsvkqayviavg
gdnpkikglpliqqfehifhfmgmsfkgyvlgegnrpgdilrdhqalsaasrllkrsda

Sequence, based on observed residues (ATOM records): (download)

>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]}
kiavinggtrsggntdvlaekavqgfdaehiyldydsiierilqchilifatpiywfgms
gtlklfidrwsqtlrdprfpdfkqqmsvkqayviavggdnpkikglpliqqfehifhfmg
msfkgyvlgegnrpgdilrdhqalsaasrllkrsda

SCOPe Domain Coordinates for d1rlia_:

Click to download the PDB-style file with coordinates for d1rlia_.
(The format of our PDB-style files is described here.)

Timeline for d1rlia_: