Lineage for d1rlha_ (1rlh A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946543Fold d.256: Ta1353-like [103164] (1 superfamily)
    core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;
  4. 1946544Superfamily d.256.1: Ta1353-like [103165] (2 families) (S)
  5. 1946545Family d.256.1.1: Ta1353-like [103166] (2 proteins)
    Pfam PF04008
  6. 1946546Protein Hypothetical protein Ta1353 [103167] (1 species)
  7. 1946547Species Thermoplasma acidophilum [TaxId:2303] [103168] (1 PDB entry)
  8. 1946548Domain d1rlha_: 1rlh A: [97646]
    structural genomics
    complexed with na

Details for d1rlha_

PDB Entry: 1rlh (more details), 1.8 Å

PDB Description: Structure of a conserved protein from Thermoplasma acidophilum
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1rlha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlha_ d.256.1.1 (A:) Hypothetical protein Ta1353 {Thermoplasma acidophilum [TaxId: 2303]}
hhhhhhssglvprgshmvipaeaniivgyshfiktvedlneiirthvpgskygigfseas
gdrlirydgndddlvkacienirrisaghtfvilirnaypinilnavkmcqevgsifaat
anplqiivykgergngvlgvidgyspvgves

SCOPe Domain Coordinates for d1rlha_:

Click to download the PDB-style file with coordinates for d1rlha_.
(The format of our PDB-style files is described here.)

Timeline for d1rlha_: