SCOPe 2.05: Domain d1rlha_: 1rlh A:

Lineage for d1rlha_ (1rlh A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.256: Ta1353-like [103164] (1 superfamily)
   core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;

4. Superfamily d.256.1: Ta1353-like [103165] (2 families)

5. Family d.256.1.1: Ta1353-like [103166] (2 proteins)
   Pfam PF04008

6. Protein Hypothetical protein Ta1353 [103167] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [103168] (1 PDB entry)

8. Domain d1rlha_: 1rlh A: [97646]
   structural genomics
   complexed with na

Details for d1rlha_

PDB Entry: 1rlh, 1.8 Å

PDB Description: Structure of a conserved protein from Thermoplasma acidophilum

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1rlha_:

Sequence; same for both SEQRES and ATOM records:

>d1rlha_ d.256.1.1 (A:) Hypothetical protein Ta1353 {Thermoplasma acidophilum [TaxId: 2303]}
hhhhhhssglvprgshmvipaeaniivgyshfiktvedlneiirthvpgskygigfseas
gdrlirydgndddlvkacienirrisaghtfvilirnaypinilnavkmcqevgsifaat
anplqiivykgergngvlgvidgyspvgves

Timeline for d1rlha_:

• d1rlha_ first appeared in SCOP 1.67
  
• d1rlha_ appears in SCOPe 2.04
  
• d1rlha_ is called d1rlha1 in SCOPe 2.06
  
• d1rlha_ appears in the current release, SCOPe 2.08, called d1rlha1