Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.256: Hypothetical protein Ta1353 [103164] (1 superfamily) core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423; |
Superfamily d.256.1: Hypothetical protein Ta1353 [103165] (1 family) |
Family d.256.1.1: Hypothetical protein Ta1353 [103166] (1 protein) |
Protein Hypothetical protein Ta1353 [103167] (1 species) |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [103168] (1 PDB entry) |
Domain d1rlha_: 1rlh A: [97646] structural genomics |
PDB Entry: 1rlh (more details), 1.8 Å
SCOP Domain Sequences for d1rlha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlha_ d.256.1.1 (A:) Hypothetical protein Ta1353 {Archaeon Thermoplasma acidophilum} hhhhhhssglvprgshmvipaeaniivgyshfiktvedlneiirthvpgskygigfseas gdrlirydgndddlvkacienirrisaghtfvilirnaypinilnavkmcqevgsifaat anplqiivykgergngvlgvidgyspvgves
Timeline for d1rlha_: