Lineage for d1rlha1 (1rlh A:1-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008980Fold d.256: Ta1353-like [103164] (1 superfamily)
    core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;
  4. 3008981Superfamily d.256.1: Ta1353-like [103165] (2 families) (S)
  5. 3008982Family d.256.1.1: Ta1353-like [103166] (2 proteins)
    Pfam PF04008
  6. 3008983Protein Hypothetical protein Ta1353 [103167] (1 species)
  7. 3008984Species Thermoplasma acidophilum [TaxId:2303] [103168] (1 PDB entry)
  8. 3008985Domain d1rlha1: 1rlh A:1-135 [97646]
    Other proteins in same PDB: d1rlha2
    structural genomics
    complexed with na

Details for d1rlha1

PDB Entry: 1rlh (more details), 1.8 Å

PDB Description: Structure of a conserved protein from Thermoplasma acidophilum
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1rlha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlha1 d.256.1.1 (A:1-135) Hypothetical protein Ta1353 {Thermoplasma acidophilum [TaxId: 2303]}
mvipaeaniivgyshfiktvedlneiirthvpgskygigfseasgdrlirydgndddlvk
acienirrisaghtfvilirnaypinilnavkmcqevgsifaatanplqiivykgergng
vlgvidgyspvgves

SCOPe Domain Coordinates for d1rlha1:

Click to download the PDB-style file with coordinates for d1rlha1.
(The format of our PDB-style files is described here.)

Timeline for d1rlha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlha2