Lineage for d1rkxd_ (1rkx D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574451Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 574615Protein CDP-glucose-4,6-dehydratase [102136] (1 species)
  7. 574616Species Yersinia pseudotuberculosis [TaxId:633] [102137] (1 PDB entry)
  8. 574620Domain d1rkxd_: 1rkx D: [97634]
    complexed with nad

Details for d1rkxd_

PDB Entry: 1rkx (more details), 1.8 Å

PDB Description: Crystal Structure at 1.8 Angstrom of CDP-D-glucose 4,6-dehydratase from Yersinia pseudotuberculosis

SCOP Domain Sequences for d1rkxd_:

Sequence, based on SEQRES records: (download)

>d1rkxd_ c.2.1.2 (D:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis}
innsfwqgkrvfvtghtgfkggwlslwlqtmgatvkgysltaptvpslfetarvadgmqs
eigdirdqnkllesirefqpeivfhmaaqplvrlsysepvetystnvmgtvylleairhv
ggvkavvnitsdkcydnkewiwgyreneamggydpysnskgcaelvtssyrnsffnpany
gqhgtavatvragnvigggdwaldrivpdilrafeqsqpviirnphairpwqhvleplsg
ylllaqklytdgaeyaegwnfgpndadatpvkniveqmvkywgegaswqldgnahpheah
ylkldcskakmqlgwhprwnlnttleyivgwhknwlsgtdmheysiteinnymntk

Sequence, based on observed residues (ATOM records): (download)

>d1rkxd_ c.2.1.2 (D:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis}
innsfwqgkrvfvtghtgfkggwlslwlqtmgatvkgysltaptvpslfetarvadgmqs
eigdirdqnkllesirefqpeivfhmaaqplvrlsysepvetystnvmgtvylleairhv
ggvkavvnitsdkcydnkewiwgyreneamggydpysnskgcaelvtssyrnsffnpany
gqhgtavatvragnvigggdwaldrivpdilrafeqsqpviirnphairpwqhvleplsg
ylllaqklytdgaeyaegwnfgpndadatpvkniveqmvkywgegaswqlhylkldcska
kmqlgwhprwnlnttleyivgwhknwlsgtdmheysiteinnymntk

SCOP Domain Coordinates for d1rkxd_:

Click to download the PDB-style file with coordinates for d1rkxd_.
(The format of our PDB-style files is described here.)

Timeline for d1rkxd_: