Lineage for d1rkxb_ (1rkx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090900Protein CDP-glucose-4,6-dehydratase [102136] (3 species)
  7. 2090905Species Yersinia pseudotuberculosis [TaxId:633] [102137] (1 PDB entry)
  8. 2090907Domain d1rkxb_: 1rkx B: [97632]
    complexed with nad

Details for d1rkxb_

PDB Entry: 1rkx (more details), 1.8 Å

PDB Description: Crystal Structure at 1.8 Angstrom of CDP-D-glucose 4,6-dehydratase from Yersinia pseudotuberculosis
PDB Compounds: (B:) CDP-glucose-4,6-dehydratase

SCOPe Domain Sequences for d1rkxb_:

Sequence, based on SEQRES records: (download)

>d1rkxb_ c.2.1.2 (B:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}
innsfwqgkrvfvtghtgfkggwlslwlqtmgatvkgysltaptvpslfetarvadgmqs
eigdirdqnkllesirefqpeivfhmaaqplvrlsysepvetystnvmgtvylleairhv
ggvkavvnitsdkcydnkewiwgyreneamggydpysnskgcaelvtssyrnsffnpany
gqhgtavatvragnvigggdwaldrivpdilrafeqsqpviirnphairpwqhvleplsg
ylllaqklytdgaeyaegwnfgpndadatpvkniveqmvkywgegaswqldgnahpheah
ylkldcskakmqlgwhprwnlnttleyivgwhknwlsgtdmheysiteinnymntk

Sequence, based on observed residues (ATOM records): (download)

>d1rkxb_ c.2.1.2 (B:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}
innsfwqgkrvfvtghtgfkggwlslwlqtmgatvkgysltaptvpslfetarvadgmqs
eigdirdqnkllesirefqpeivfhmaaqplvrlsysepvetystnvmgtvylleairhv
ggvkavvnitsdkcydnkewiwgyreneamggydpysnskgcaelvtssyrnsffnpany
gqhgtavatvragnvigggdwaldrivpdilrafeqsqpviirnphairpwqhvleplsg
ylllaqklytdgaeyaegwnfgpndadatpvkniveqmvkywgegaswqhylkldcskak
mqlgwhprwnlnttleyivgwhknwlsgtdmheysiteinnymntk

SCOPe Domain Coordinates for d1rkxb_:

Click to download the PDB-style file with coordinates for d1rkxb_.
(The format of our PDB-style files is described here.)

Timeline for d1rkxb_: