Lineage for d1rkub_ (1rku B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404418Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 404419Superfamily c.108.1: HAD-like [56784] (14 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 404548Family c.108.1.11: Homoserine kinase ThrH [102304] (1 protein)
    the insertion subdomain is a rudiment 4-helical bundle
  6. 404549Protein Homoserine kinase ThrH [102305] (1 species)
  7. 404550Species Pseudomonas aeruginosa [TaxId:287] [102306] (2 PDB entries)
  8. 404552Domain d1rkub_: 1rku B: [97628]
    complexed with edo, mg

Details for d1rkub_

PDB Entry: 1rku (more details), 1.47 Å

PDB Description: Crystal Structure of ThrH gene product of Pseudomonas Aeruginosa

SCOP Domain Sequences for d1rkub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkub_ c.108.1.11 (B:) Homoserine kinase ThrH {Pseudomonas aeruginosa}
dmeiacldlegvlvpeiwiafaektgidalkattrdipdydvlmkqrlrildehglklgd
iqeviatlkplegavefvdwlrerfqvvilsdtfyefsqplmrqlgfptllchkleidds
drvvgyqlrqkdpkrqsviafkslyyrviaagdsyndttmlseahagilfhapenviref
pqfpavhtyedlkreflkassrslsl

SCOP Domain Coordinates for d1rkub_:

Click to download the PDB-style file with coordinates for d1rkub_.
(The format of our PDB-style files is described here.)

Timeline for d1rkub_: