Lineage for d1rktb2 (1rkt B:83-205)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. Protein Hypothetical transcriptional regulator YfiR [101430] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [101431] (1 PDB entry)
  8. Domain d1rktb2: 1rkt B:83-205 [97626]
    Other proteins in same PDB: d1rkta1, d1rktb1
    structural genomics
    complexed with unx

Details for d1rktb2

PDB Entry: 1rkt (more details), 1.95 Å

PDB Description: Crystal structure of yfiR, a putative transcriptional regulator from Bacillus subtilis
PDB Compounds: (B:) protein yfiR

SCOPe Domain Sequences for d1rktb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rktb2 a.121.1.1 (B:83-205) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]}
svwasissyldelteglrdvadtlapvqfeylvtawrneerrqylekrydlfverfsrll
qkgidqgefqpvqplatiakfflnmndgiiqnalyfdeekadvsglaesaklylktvlqa
dek

SCOPe Domain Coordinates for d1rktb2 are not available.

Timeline for d1rktb2:

Domains from same chain:
(mouse over for more information)
d1rktb1
Domains from other chains:
(mouse over for more information)
d1rkta1, d1rkta2