Lineage for d1rktb1 (1rkt B:6-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692287Protein Hypothetical transcriptional regulator YfiR [101005] (1 species)
  7. 2692288Species Bacillus subtilis [TaxId:1423] [101006] (1 PDB entry)
  8. 2692290Domain d1rktb1: 1rkt B:6-82 [97625]
    Other proteins in same PDB: d1rkta2, d1rktb2
    structural genomics
    complexed with unx

Details for d1rktb1

PDB Entry: 1rkt (more details), 1.95 Å

PDB Description: Crystal structure of yfiR, a putative transcriptional regulator from Bacillus subtilis
PDB Compounds: (B:) protein yfiR

SCOPe Domain Sequences for d1rktb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rktb1 a.4.1.9 (B:6-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]}
tkehkdkrqaeileaaktvfkrkgfelttmkdvveesgfsrggvylyfssteemfrriie
tgldeglrkldksaehq

SCOPe Domain Coordinates for d1rktb1:

Click to download the PDB-style file with coordinates for d1rktb1.
(The format of our PDB-style files is described here.)

Timeline for d1rktb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rktb2