Lineage for d1rkta2 (1rkt A:83-205)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543325Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 543326Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 543327Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 543345Protein Hypothetical transcriptional regulator YfiR [101430] (1 species)
  7. 543346Species Bacillus subtilis [TaxId:1423] [101431] (1 PDB entry)
  8. 543347Domain d1rkta2: 1rkt A:83-205 [97624]
    Other proteins in same PDB: d1rkta1, d1rktb1

Details for d1rkta2

PDB Entry: 1rkt (more details), 1.95 Å

PDB Description: Crystal structure of yfiR, a putative transcriptional regulator from Bacillus subtilis

SCOP Domain Sequences for d1rkta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkta2 a.121.1.1 (A:83-205) Hypothetical transcriptional regulator YfiR {Bacillus subtilis}
svwasissyldelteglrdvadtlapvqfeylvtawrneerrqylekrydlfverfsrll
qkgidqgefqpvqplatiakfflnmndgiiqnalyfdeekadvsglaesaklylktvlqa
dek

SCOP Domain Coordinates for d1rkta2:

Click to download the PDB-style file with coordinates for d1rkta2.
(The format of our PDB-style files is described here.)

Timeline for d1rkta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rkta1