![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Hypothetical transcriptional regulator YfiR [101430] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101431] (1 PDB entry) |
![]() | Domain d1rkta2: 1rkt A:83-205 [97624] Other proteins in same PDB: d1rkta1, d1rktb1 structural genomics complexed with unx |
PDB Entry: 1rkt (more details), 1.95 Å
SCOPe Domain Sequences for d1rkta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkta2 a.121.1.1 (A:83-205) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]} svwasissyldelteglrdvadtlapvqfeylvtawrneerrqylekrydlfverfsrll qkgidqgefqpvqplatiakfflnmndgiiqnalyfdeekadvsglaesaklylktvlqa dek
Timeline for d1rkta2: