![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (13 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins) |
![]() | Protein Hypothetical transcriptional regulator YfiR [101005] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101006] (1 PDB entry) |
![]() | Domain d1rkta1: 1rkt A:2-82 [97623] Other proteins in same PDB: d1rkta2, d1rktb2 |
PDB Entry: 1rkt (more details), 1.95 Å
SCOP Domain Sequences for d1rkta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkta1 a.4.1.9 (A:2-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis} spkvtkehkdkrqaeileaaktvfkrkgfelttmkdvveesgfsrggvylyfssteemfr riietgldeglrkldksaehq
Timeline for d1rkta1: