SCOP 1.67: Domain d1rkqa_: 1rkq A:

Lineage for d1rkqa_ (1rkq A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (14 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (4 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Hypothetical protein YidA [102315] (1 species)

7. Species Escherichia coli [TaxId:562] [102316] (1 PDB entry)

8. Domain d1rkqa_: 1rkq A: [97621]

Details for d1rkqa_

PDB Entry: 1rkq, 1.4 Å

PDB Description: crystal structure of had-like phosphatase yida from e. coli

SCOP Domain Sequences for d1rkqa_:

Sequence; same for both SEQRES and ATOM records:

>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli}
slaikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhm
eqpgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytan
rdisyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkekyt
vlksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavdn
aipsvkevanfvtksnledgvafaiekyvln

Timeline for d1rkqa_:

• d1rkqa_ is new in SCOP 1.67
  
• d1rkqa_ appears in SCOP 1.69
  
• d1rkqa_ appears in the current release, SCOPe 2.08, called d1rkqa1