SCOPe 2.08: Domain d1rkqa1: 1rkq A:3-271

Lineage for d1rkqa1 (1rkq A:3-271)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Hypothetical protein YidA [102315] (1 species)

7. Species Escherichia coli [TaxId:562] [102316] (1 PDB entry)

8. Domain d1rkqa1: 1rkq A:3-271 [97621]
   Other proteins in same PDB: d1rkqa2, d1rkqb2
   structural genomics; NYSGRC target T1436
   complexed with cl, mg

Details for d1rkqa1

PDB Entry: 1rkq, 1.4 Å

PDB Description: crystal structure of had-like phosphatase yida from e. coli

PDB Compounds: (A:) Hypothetical protein yidA

SCOPe Domain Sequences for d1rkqa1:

Sequence; same for both SEQRES and ATOM records:

>d1rkqa1 c.108.1.10 (A:3-271) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}
aikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhmeq
pgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytanrd
isyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkekytvl
ksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavdnai
psvkevanfvtksnledgvafaiekyvln

Timeline for d1rkqa1:

• d1rkqa1 first appeared in SCOP 1.67, called d1rkqa_
  
• d1rkqa1 appears in SCOPe 2.07