Lineage for d1rkja2 (1rkj A:92-175)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1415603Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1415762Protein Nucleolin [54952] (1 species)
  7. 1415763Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54953] (4 PDB entries)
  8. 1415769Domain d1rkja2: 1rkj A:92-175 [97614]
    protein/RNA complex

Details for d1rkja2

PDB Entry: 1rkj (more details)

PDB Description: solution structure of the complex formed by the two n-terminal rna- binding domains of nucleolin and a pre-rrna target
PDB Compounds: (A:) Nucleolin

SCOPe Domain Sequences for d1rkja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkja2 d.58.7.1 (A:92-175) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
dskkvraartllaknlsfnitedelkevfedaleirlvsqdgkskgiayiefkseadaek
nleekqgaeidgrsvslyytgekg

SCOPe Domain Coordinates for d1rkja2:

Click to download the PDB-style file with coordinates for d1rkja2.
(The format of our PDB-style files is described here.)

Timeline for d1rkja2: